CNTF (NM_000614) Human Mass Spec Standard

CAT#: PH322331

CNTF MS Standard C13 and N15-labeled recombinant protein (NP_000605)

Product Images

Coomassie blue staining of purified CNTF protein (Cat# TP322331). The protein was produced from HEK293T cells transfected with CNTF cDNA clone (Cat# RC222331) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222331
• Predicted MW: 22.8 kDa
• Protein Sequence:
  Sequence Link

  >RC222331 representing NM_000614
  Red=Cloning site Green=Tags(s)
  
  MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEA
  ERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEAD
  GMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000605
• RefSeq Size: 1891
• RefSeq ORF: 600
• Synonyms: HCNTF
• Locus ID: 1270
• UniProt ID: P26441
• Cytogenetics: 11q12.1
• Summary: The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of the upstream ZFP91 gene and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq, Oct 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway