OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TCN1 (NM_001062) Human Mass Spec Standard

Be the first to review this product
SKU
PH322285
TCN1 MS Standard C13 and N15-labeled recombinant protein (NP_001053)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA382381 TCN1 Rabbit polyclonal Antibody
100 ul
$410.00
LY400432 Transient overexpression lysate of transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1) (as WB positive control) 100 ug
$665.00

Other products for "TCN1 or NM_001062"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222285
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC222285 representing NM_001062
Red=Cloning site Green=Tags(s)

MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQT
LMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTP
LTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKAD
EGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQGA
FSNPNAAAQVLPALMGKTFLDINKDSSCVSASGNFNISADEPITVTPPDSQSYISVNYSVRINETYFTNV
TVLNGSVFLSVMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRTYWELLSGGEPLSQGAGSYVV
RNG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001053
RefSeq Size 1576
RefSeq ORF 1269
Synonyms HC; TC-1; TC1; TCI
Locus ID 6947
UniProt ID P20061
Cytogenetics 11q12.1
Summary This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This protein is a major constituent of secondary granules in neutrophils and facilitates the transport of cobalamin into cells. provided by RefSeq, Jul 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TCN1" proteins (3)
SKU Description Size Price
LC400432 Lyophilized TCN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400432 Transient overexpression lysate of transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1) (as WB positive control) 100 ug
$665.00
TP322285 Recombinant protein of human transcobalamin I (vitamin B12 binding protein, R binder family) (TCN1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products