OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CORO1B (NM_001018070) Human Mass Spec Standard

Be the first to review this product
SKU
PH322047
CORO1B MS Standard C13 and N15-labeled recombinant protein (NP_001018080)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501573 Anti-CORO1B (Coronin 1b) mouse monoclonal antibody, clone OTI3D10 (formerly 3D10) 100 ul
$447.00
LY402787 Transient overexpression lysate of coronin, actin binding protein, 1B (CORO1B), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CORO1B or NM_001018070"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222047
Predicted MW 54.2 kDa
Protein Sequence
Protein Sequence
>RC222047 protein sequence
Red=Cloning site Green=Tags(s)

MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGR
IDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAW
HPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTL
VAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTS
VVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVM
TVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMA
PGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001018080
RefSeq Size 1949
RefSeq ORF 1467
Synonyms CORONIN-2
Locus ID 57175
UniProt ID Q9BR76
Cytogenetics 11q13.2
Summary Members of the coronin family, such as CORO1B, are WD repeat-containing actin-binding proteins that regulate cell motility (Cai et al., 2005 PubMed 16027158).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CORO1B" proteins (7)
SKU Description Size Price
PH303023 CORO1B MS Standard C13 and N15-labeled recombinant protein (NP_065174) 10 ug
$3,360.00
LC402787 Lyophilized CORO1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422721 Lyophilized CORO1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402787 Transient overexpression lysate of coronin, actin binding protein, 1B (CORO1B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422721 Transient overexpression lysate of coronin, actin binding protein, 1B (CORO1B), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP303023 Recombinant protein of human coronin, actin binding protein, 1B (CORO1B), transcript variant 1, 20 µg 20 ug
$737.00
TP322047 Recombinant protein of human coronin, actin binding protein, 1B (CORO1B), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products