OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Muted (BLOC1S5) (NM_201280) Human Mass Spec Standard

Be the first to review this product
SKU
PH321922
MUTED MS Standard C13 and N15-labeled recombinant protein (NP_958437)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343285 Rabbit Polyclonal Anti-BLOC1S5 Antibody
100 ul
$585.00
LY404512 Transient overexpression lysate of muted homolog (mouse) (MUTED) (as WB positive control) 100 ug
$436.00

Other products for "Muted or NM_201280"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221922
Predicted MW 21.6 kDa
Protein Sequence
Protein Sequence
>RC221922 protein sequence
Red=Cloning site Green=Tags(s)

MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGL
REMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQ
HMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_958437
RefSeq Size 2695
RefSeq ORF 561
Synonyms BLOS5; HPS11; MU; MUTED
Locus ID 63915
UniProt ID Q8TDH9
Cytogenetics 6p24.3
Summary This gene encodes a component of BLOC-1 (biogenesis of lysosome-related organelles complex 1). Components of this complex are involved in the biogenesis of organelles such as melanosomes and platelet-dense granules. A mouse model for Hermansky-Pudlak Syndrome is mutated in the murine version of this gene. Alternative splicing results in multiple transcript variants. Read-through transcription exists between this gene and the upstream EEF1E1 (eukaryotic translation elongation factor 1 epsilon 1) gene, as well as with the downstream TXNDC5 (thioredoxin domain containing 5) gene. provided by RefSeq, Dec 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Muted" proteins (3)
SKU Description Size Price
LC404512 Lyophilized BLOC1S5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404512 Transient overexpression lysate of muted homolog (mouse) (MUTED) (as WB positive control) 100 ug
$436.00
TP321922 Recombinant protein of human muted homolog (mouse) (MUTED), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products