LIN7 (LIN7A) (NM_004664) Human Mass Spec Standard

CAT#: PH321902

LIN7A MS Standard C13 and N15-labeled recombinant protein (NP_004655)

Product Images

Coomassie blue staining of purified LIN7A protein (Cat# TP321902). The protein was produced from HEK293T cells transfected with LIN7A cDNA clone (Cat# RC221902) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221902
• Predicted MW: 26 kDa
• Protein Sequence:
  Sequence Link

  >RC221902 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQ
  YMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPG
  GVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQ
  QQQLLIQQQQQQQQQQTQQNHMS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004655
• RefSeq Size: 1235
• RefSeq ORF: 699
• Synonyms: LIN-7A; LIN7; MALS-1; MALS1; TIP-33; VELI1
• Locus ID: 8825
• UniProt ID: O14910
• Cytogenetics: 12q21.31
• Summary: The protein encoded by this gene is involved in generating and maintaining the asymmetric distribution of channels and receptors at the cell membrane. The encoded protein also is required for the localization of some specific channels and can be part of a protein complex that couples synaptic vesicle exocytosis to cell adhesion in the brain. [provided by RefSeq, May 2016]
• Protein Families: Druggable Genome