CLEC17A (NM_207390) Human Mass Spec Standard

CAT#: PH321901

CLEC17A MS Standard C13 and N15-labeled recombinant protein (NP_997273)

Product Images

Coomassie blue staining of purified CLEC17A protein (Cat# TP321901). The protein was produced from HEK293T cells transfected with CLEC17A cDNA clone (Cat# RC221901) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221901
• Predicted MW: 32.2 kDa
• Protein Sequence:
  Sequence Link

  >RC221901 representing NM_207390
  Red=Cloning site Green=Tags(s)
  
  MHNLYSITGYPDPPGTMEEEEEDDDYENSTPPYKDLPPKPGTMEEEEEDDDYENSTPPYKDLPPKPGTME
  EEEEDDDYENSTPPYKDLPPKPGSSAPPRPPRAAKETEKPPLPCKPRNMTGLDLAAVTCPPPQLAVNLEP
  SPLQPSLAATPVPWLNQRSGGPGCCQKRWMVYLCLLVVTSLFLGCLGLTVTLIKYQELMEELRMLSFQQM
  TWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARM
  FCQENYSHLVIINSFAEHLLGARGTQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_997273
• RefSeq Size: 2090
• RefSeq ORF: 918
• Locus ID: 388512
• UniProt ID: Q6ZS10
• Cytogenetics: 19p13.12
• Summary: Cell surface receptor which may be involved in carbohydrate-mediated communication between cells in the germinal center. Binds glycans with terminal alpha-linked mannose or fucose residues.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane