JPT1 (NM_016185) Human Mass Spec Standard

CAT#: PH321865

HN1 MS Standard C13 and N15-labeled recombinant protein (NP_057269)

Product Images

Coomassie blue staining of purified JPT1 protein (Cat# TP321865). The protein was produced from HEK293T cells transfected with JPT1 cDNA clone (Cat# RC221865) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221865
• Predicted MW: 15.8 kDa
• Protein Sequence:
  Sequence Link

  >RC221865 representing NM_016185
  Red=Cloning site Green=Tags(s)
  
  MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKSAGAKS
  SGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSLGQSEEKPVPAAPVPSPVAPAPVPS
  RRNPPGGKSSLVLG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057269
• RefSeq Size: 1602
• RefSeq ORF: 462
• Synonyms: ARM2; HN1; HN1A
• Locus ID: 51155
• UniProt ID: Q9UK76
• Cytogenetics: 17q25.1
• Summary: Modulates negatively AKT-mediated GSK3B signaling (PubMed:21323578, PubMed:22155408). Induces CTNNB1 'Ser-33' phosphorylation and degradation through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, which represses the function of the APC:CTNNB1:GSK3B complex and the interaction with CDH1/E-cadherin in adherent junctions (PubMed:25169422). Plays a role in the regulation of cell cycle and cell adhesion (PubMed:25169422, PubMed:25450365). Has an inhibitory role on AR-signaling pathway through the induction of receptor proteosomal degradation (PubMed:22155408).[UniProtKB/Swiss-Prot Function]