OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

JPT1 (NM_016185) Human Mass Spec Standard

Be the first to review this product
SKU
PH321865
HN1 MS Standard C13 and N15-labeled recombinant protein (NP_057269)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308121 Rabbit polyclonal antibody to HN1 (hematological and neurological expressed 1)
100 ul
$665.00
LY414136 Transient overexpression lysate of hematological and neurological expressed 1 (HN1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "JPT1 or NM_016185"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221865
Predicted MW 15.8 kDa
Protein Sequence
Protein Sequence
>RC221865 representing NM_016185
Red=Cloning site Green=Tags(s)

MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKSAGAKS
SGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSLGQSEEKPVPAAPVPSPVAPAPVPS
RRNPPGGKSSLVLG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057269
RefSeq Size 1602
RefSeq ORF 462
Synonyms ARM2; HN1; HN1A
Locus ID 51155
UniProt ID Q9UK76
Cytogenetics 17q25.1
Summary Modulates negatively AKT-mediated GSK3B signaling (PubMed:21323578, PubMed:22155408). Induces CTNNB1 'Ser-33' phosphorylation and degradation through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, which represses the function of the APC:CTNNB1:GSK3B complex and the interaction with CDH1/E-cadherin in adherent junctions (PubMed:25169422). Plays a role in the regulation of cell cycle and cell adhesion (PubMed:25169422, PubMed:25450365). Has an inhibitory role on AR-signaling pathway through the induction of receptor proteosomal degradation (PubMed:22155408).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "JPT1" proteins (7)
SKU Description Size Price
PH307344 HN1 MS Standard C13 and N15-labeled recombinant protein (NP_001002033) 10 ug
$3,360.00
LC414136 Lyophilized HN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424172 Lyophilized HN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414136 Transient overexpression lysate of hematological and neurological expressed 1 (HN1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY424172 Transient overexpression lysate of hematological and neurological expressed 1 (HN1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP307344 Recombinant protein of human hematological and neurological expressed 1 (HN1), transcript variant 3, 20 µg 20 ug
$867.00
TP321865 Recombinant protein of human hematological and neurological expressed 1 (HN1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products