OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPRR2E (NM_001024209) Human Mass Spec Standard

Be the first to review this product
SKU
PH321721
SPRR2E MS Standard C13 and N15-labeled recombinant protein (NP_001019380)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422617 Transient overexpression lysate of small proline-rich protein 2E (SPRR2E) (as WB positive control) 100 ug
$436.00

Other products for "SPRR2E or NM_001024209"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221721
Predicted MW 7.7 kDa
Protein Sequence
Protein Sequence
>RC221721 representing NM_001024209
Red=Cloning site Green=Tags(s)

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPSPPCQPKCPPK
SK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001019380
RefSeq Size 762
RefSeq ORF 216
Locus ID 6704
UniProt ID P22531
Cytogenetics 1q21.3
Summary This gene encodes a member of a family of small proline-rich proteins clustered in the epidermal differentiation complex on chromosome 1q21. The encoded protein, along with other family members, is a component of the cornified cell envelope that forms beneath the plasma membrane in terminally differentiated stratified squamous epithelia. This envelope serves as a barrier against extracellular and environmental factors. The seven SPRR2 genes (A-G) appear to have been homogenized by gene conversion compared to others in the cluster that exhibit greater differences in protein structure. provided by RefSeq, Feb 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPRR2E" proteins (3)
SKU Description Size Price
LC422617 Lyophilized SPRR2E HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422617 Transient overexpression lysate of small proline-rich protein 2E (SPRR2E) (as WB positive control) 100 ug
$436.00
TP321721 Recombinant protein of human small proline-rich protein 2E (SPRR2E), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products