CD105 (ENG) (NM_000118) Human Mass Spec Standard
CAT#: PH321699
ENG MS Standard C13 and N15-labeled recombinant protein (NP_000109)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221699 |
Predicted MW | 67.78 kDa |
Protein Sequence |
>RC221699 representing NM_000118
Red=Cloning site Green=Tags(s) MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLE FPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPS FPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE GVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFK IFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTC SPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASM ISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQL DSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQ DQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTREYPRPPQSGP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000109 |
RefSeq Size | 3142 |
RefSeq ORF | 1884 |
Synonyms | END; HHT1; ORW1 |
Locus ID | 2022 |
UniProt ID | P17813, Q5T9B9 |
Cytogenetics | 9q34.11 |
Summary | This gene encodes a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. Mutations in this gene cause hereditary hemorrhagic telangiectasia, also known as Osler-Rendu-Weber syndrome 1, an autosomal dominant multisystemic vascular dysplasia. This gene may also be involved in preeclampsia and several types of cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2013] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424919 | ENG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC426509 | ENG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424919 | Transient overexpression lysate of endoglin (ENG), transcript variant 2 |
USD 665.00 |
|
LY426509 | Transient overexpression lysate of endoglin (ENG), transcript variant 1 |
USD 436.00 |
|
PH326069 | ENG MS Standard C13 and N15-labeled recombinant protein (NP_001108225) |
USD 3,255.00 |
|
TP321699 | Recombinant protein of human endoglin (ENG), transcript variant 2, 20 µg |
USD 867.00 |
|
TP326069 | Purified recombinant protein of Homo sapiens endoglin (ENG), transcript variant 1, 20 µg |
USD 867.00 |
|
TP721000 | Purified recombinant protein of Human endoglin (ENG), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review