OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLEC2D (NM_001004419) Human Mass Spec Standard

Be the first to review this product
SKU
PH321680
CLEC2D MS Standard C13 and N15-labeled recombinant protein (NP_001004419)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349280 Rabbit Polyclonal Anti-CLEC2D Antibody
100 ul
$205.00
LY423748 Transient overexpression lysate of C-type lectin domain family 2, member D (CLEC2D), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CLEC2D or NM_001004419"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221680
Predicted MW 22.1 kDa
Protein Sequence
Protein Sequence
>RC221680 representing NM_001004419
Red=Cloning site Green=Tags(s)

MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC
LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG
QPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRRVCLFE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001004419
RefSeq Size 1821
RefSeq ORF 582
Synonyms CLAX; LLT1; OCIL
Locus ID 29121
UniProt ID Q9UHP7
Cytogenetics 12p13.31
Summary This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. provided by RefSeq, Oct 2010
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CLEC2D" proteins (7)
SKU Description Size Price
LC415703 Lyophilized CLEC2D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423748 Lyophilized CLEC2D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433996 Lyophilized CLEC2D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415703 Transient overexpression lysate of C-type lectin domain family 2, member D (CLEC2D), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423748 Transient overexpression lysate of C-type lectin domain family 2, member D (CLEC2D), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY433996 Transient overexpression lysate of C-type lectin domain family 2, member D (CLEC2D), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP321680 Recombinant protein of human C-type lectin domain family 2, member D (CLEC2D), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products