OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Fibulin 1 (FBLN1) (NM_006486) Human Mass Spec Standard

Be the first to review this product
SKU
PH321597
FBLN1 MS Standard C13 and N15-labeled recombinant protein (NP_006477)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA323077 Anti-FBLN1 Rabbit Polyclonal Antibody
100 ul
$305.00
LY416607 Transient overexpression lysate of fibulin 1 (FBLN1), transcript variant A (as WB positive control) 100 ug
$665.00

Other products for "Fibulin 1 or NM_006486"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221597
Predicted MW 77.24 kDa
Protein Sequence
Protein Sequence
>RC221597 representing NM_006486
Red=Cloning site Green=Tags(s)

MERAAPSRRVPLPLLLLGGLALLAAGVDADVLLEACCADGHRMATHQKDCSLPYATESKECRMVQEQCCH
SQLEELHCATGISLANEQDRCATPHGDNASLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQVF
RACCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSD
GVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDNSCKDIDECESGIHNCLPDFICQ
NTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEE
GTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLG
SYLCSCSVGFRLSVDGRSCEDINECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTG
GHICSYRCINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPENY
RRSAATLQQEKTDTVRCIKSCRPNDVTCVFDPVHTISHTVISLPTFREFTRPEEIIFLRAITPPHPASQA
NIIFDITEGNLRDSFDIIKRYMDGMTVGVVRQVRPIVGPFHAVLKLEMNYVVGGVVSHRNVVNVHIFVSE
YWF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006477
RefSeq Size 2947
RefSeq ORF 2109
Synonyms FBLN; FIBL1
Locus ID 2192
UniProt ID P23142
Cytogenetics 22q13.31
Summary Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3' end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants. provided by RefSeq, Jul 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Fibulin 1" proteins (5)
SKU Description Size Price
LC416606 Lyophilized FBLN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416607 Lyophilized FBLN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416606 Transient overexpression lysate of fibulin 1 (FBLN1), transcript variant D (as WB positive control) 100 ug
$665.00
LY416607 Transient overexpression lysate of fibulin 1 (FBLN1), transcript variant A (as WB positive control) 100 ug
$665.00
TP321597 Recombinant protein of human fibulin 1 (FBLN1), transcript variant D, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products