OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CED6 (GULP1) (NM_016315) Human Mass Spec Standard

Be the first to review this product
SKU
PH321580
GULP1 MS Standard C13 and N15-labeled recombinant protein (NP_057399)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA376884 GULP1 Rabbit polyclonal Antibody
100 ul
$410.00
LY414050 Transient overexpression lysate of GULP, engulfment adaptor PTB domain containing 1 (GULP1) (as WB positive control) 100 ug
$436.00

Other products for "CED6 or NM_016315"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221580
Predicted MW 34.3 kDa
Protein Sequence
Protein Sequence
>RC221580 representing NM_016315
Red=Cloning site Green=Tags(s)

MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKV
ELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLT
IGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSAPPAGSMTPK
SPSTDIFDMIPFSPISHQSSMPTRNGTQPPPVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEM
QEGFKMGLTLEGTVFCLDPLDSRC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057399
RefSeq Size 3464
RefSeq ORF 912
Synonyms CED-6; CED6; GULP
Locus ID 51454
UniProt ID Q9UBP9
Cytogenetics 2q32.1-q32.2
Summary The protein encoded by this gene is an adapter protein necessary for the engulfment of apoptotic cells by phagocytes. Several transcript variants, some protein coding and some thought not to be protein coding, have been found for this gene. provided by RefSeq, Nov 2011
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CED6" proteins (3)
SKU Description Size Price
LC414050 Lyophilized GULP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414050 Transient overexpression lysate of GULP, engulfment adaptor PTB domain containing 1 (GULP1) (as WB positive control) 100 ug
$436.00
TP321580 Recombinant protein of human GULP, engulfment adaptor PTB domain containing 1 (GULP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products