TIGIT (NM_173799) Human Mass Spec Standard
CAT#: PH321447
TIGIT MS Standard C13 and N15-labeled recombinant protein (NP_776160)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221447 |
Predicted MW | 26.3 kDa |
Protein Sequence |
>RC221447 protein sequence
Red=Cloning site Green=Tags(s) MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICN ADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQI PLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGL CGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_776160 |
RefSeq Size | 2978 |
RefSeq ORF | 732 |
Synonyms | VSIG9; VSTM3; WUCAM |
Locus ID | 201633 |
UniProt ID | Q495A1 |
Cytogenetics | 3q13.31 |
Summary | This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.[provided by RefSeq, Sep 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406575 | TIGIT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY406575 | Transient overexpression lysate of T cell immunoreceptor with Ig and ITIM domains (TIGIT) |
USD 436.00 |
|
TP321447 | Recombinant protein of human T cell immunoreceptor with Ig and ITIM domains (TIGIT), 20 µg |
USD 867.00 |
|
TP700214 | Purified recombinant protein of human T cell immunoreceptor with Ig and ITIM domains (TIGIT), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 867.00 |
|
TP723994 | Human TIGIT Protein, hFc Tag |
USD 535.00 |
|
TP724032 | Human TIGIT Protein, mFc Tag |
USD 495.00 |
|
TP724033 | Human TIGIT Protein, His Tag |
USD 495.00 |
{0} Product Review(s)
Be the first one to submit a review