NUMB (NM_001005744) Human Mass Spec Standard
CAT#: PH321018
NUMB MS Standard C13 and N15-labeled recombinant protein (NP_001005744)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221018 |
Predicted MW | 65.7 kDa |
Protein Sequence |
>RC221018 representing NM_001005744
Red=Cloning site Green=Tags(s) MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERK FFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWI CHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIM KQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGF PALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPM TKPVTVVAPQSPTFQGTEWGQSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQ PPPPTAISQPASPFQGNAFLTSQPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANV FGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPT GTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001005744 |
RefSeq Size | 3503 |
RefSeq ORF | 1809 |
Synonyms | C14orf41; c14_5527; S171 |
Locus ID | 8650 |
UniProt ID | P49757, A0A024R681 |
Cytogenetics | 14q24.2-q24.3 |
Summary | The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Protein Pathways | Notch signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401229 | NUMB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC423643 | NUMB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC423644 | NUMB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY401229 | Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 3 |
USD 665.00 |
|
LY423643 | Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 1 |
USD 665.00 |
|
LY423644 | Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 2 |
USD 665.00 |
|
PH320960 | NUMB MS Standard C13 and N15-labeled recombinant protein (NP_001005743) |
USD 3,255.00 |
|
TP320960 | Recombinant protein of human numb homolog (Drosophila) (NUMB), transcript variant 1, 20 µg |
USD 867.00 |
|
TP321018 | Recombinant protein of human numb homolog (Drosophila) (NUMB), transcript variant 2, 20 µg |
USD 867.00 |
|
TP710054 | Recombinant protein of human numb homolog (Drosophila)(MUMB),residues 1-603aa, with C-terminal flag tag,expressed in sf9 cells |
USD 515.00 |
|
TP761513 | Purified recombinant protein of Human numb homolog (Drosophila) (NUMB), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review