NUMB (NM_001005743) Human Mass Spec Standard

SKU
PH320960
NUMB MS Standard C13 and N15-labeled recombinant protein (NP_001005743)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220960]
Predicted MW 70.6 kDa
Protein Sequence
Protein Sequence
>RC220960 representing NM_001005743
Red=Cloning site Green=Tags(s)

MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERK
FFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWI
CHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAKREEIM
KQMQDAKKAETDKIVVGSSVAPGNTAPSPSSPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGF
PALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPM
TKPVTVVAPQSPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS
SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPASPFQGNAFLTS
QPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQ
TFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQR
TNPSPTNPFSSDLQKTFEIEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001005743
RefSeq Size 3647
RefSeq ORF 1953
Synonyms C14orf41; c14_5527; S171
Locus ID 8650
UniProt ID P49757
Cytogenetics 14q24.2-q24.3
Summary The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Protein Pathways Notch signaling pathway
Write Your Own Review
You're reviewing:NUMB (NM_001005743) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321018 NUMB MS Standard C13 and N15-labeled recombinant protein (NP_001005744) 10 ug
$3,255.00
LC401229 NUMB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423643 NUMB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423644 NUMB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401229 Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 3 100 ug
$665.00
LY423643 Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 1 100 ug
$665.00
LY423644 Transient overexpression lysate of numb homolog (Drosophila) (NUMB), transcript variant 2 100 ug
$665.00
TP320960 Recombinant protein of human numb homolog (Drosophila) (NUMB), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321018 Recombinant protein of human numb homolog (Drosophila) (NUMB), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP710054 Recombinant protein of human numb homolog (Drosophila)(MUMB),residues 1-603aa, with C-terminal flag tag,expressed in sf9 cells 20 ug
$515.00
TP761513 Purified recombinant protein of Human numb homolog (Drosophila) (NUMB), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.