OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

APOBEC3A (NM_145699) Human Mass Spec Standard

Be the first to review this product
SKU
PH320995
APOBEC3A MS Standard C13 and N15-labeled recombinant protein (NP_663745)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA389619 APOBEC3A Rabbit pAb
100 ul
$410.00
LY407901 Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A (APOBEC3A) (as WB positive control) 100 ug
$436.00

Other products for "APOBEC3A or NM_145699"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220995
Predicted MW 22.8 kDa
Protein Sequence
Protein Sequence
>RC220995 protein sequence
Red=Cloning site Green=Tags(s)

MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRH
AELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEAL
QMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_663745
RefSeq Size 1349
RefSeq ORF 597
Synonyms A3A; ARP3; bK150C2.1; PHRBN
Locus ID 200315
UniProt ID P31941
Cytogenetics 22q13.1
Summary This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene lacks the zinc binding activity of other family members. The protein plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "APOBEC3A" proteins (3)
SKU Description Size Price
LC407901 Lyophilized APOBEC3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407901 Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A (APOBEC3A) (as WB positive control) 100 ug
$436.00
TP320995 Purified recombinant protein of Homo sapiens apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A (APOBEC3A), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products