OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CHI3L2 (NM_004000) Human Mass Spec Standard

Be the first to review this product
SKU
PH320804
CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_003991)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365638 CHI3L2 rabbit polyclonal antibody
100 ul
$310.00
LY400404 Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "CHI3L2 or NM_004000"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220804
Predicted MW 43.5 kDa
Protein Sequence
Protein Sequence
>RC220804 protein sequence
Red=Cloning site Green=Tags(s)

MGATTMDQKSLWAGVVVLLLLQGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNK
VIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGL
DVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKERLLLTVGVSAGRQMIDNSYQVEKLAKDLDFINLL
SFDFHGSWEKPLITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAET
TVGAPASGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLK
NLNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003991
RefSeq Size 1486
RefSeq ORF 1170
Synonyms CHIL2; YKL-39; YKL39
Locus ID 1117
UniProt ID Q15782
Cytogenetics 1p13.2
Summary The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Apr 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CHI3L2" proteins (11)
SKU Description Size Price
PH303807 CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020370) 10 ug
$3,360.00
PH320858 CHI3L2 MS Standard C13 and N15-labeled recombinant protein (NP_001020368) 10 ug
$3,360.00
LC400404 Lyophilized CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418266 Lyophilized CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422601 Lyophilized CHI3L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400404 Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY418266 Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422601 Transient overexpression lysate of chitinase 3-like 2 (CHI3L2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303807 Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 3, 20 µg 20 ug
$867.00
TP320804 Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 1, 20 µg 20 ug
$867.00
TP320858 Recombinant protein of human chitinase 3-like 2 (CHI3L2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products