OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Osteocalcin (BGLAP) (NM_199173) Human Mass Spec Standard

Be the first to review this product
SKU
PH320555
BGLAP MS Standard C13 and N15-labeled recombinant protein (NP_954642)
Size:
10 ug
  $3,360.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA321966 Anti-BGLAP Rabbit Polyclonal Antibody
100 ul
$305.00
LY404673 Transient overexpression lysate of bone gamma-carboxyglutamate (gla) protein (BGLAP) (as WB positive control) 100 ug
$436.00

Other products for "Osteocalcin or NM_199173"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220555
Predicted MW 8.7 kDa
Protein Sequence
Protein Sequence
>RC220555 representing NM_199173
Red=Cloning site Green=Tags(s)

MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPR
REVCELNPDCDELADHIGFQEAYRRFYGPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_954642
RefSeq Size 498
RefSeq ORF 300
Synonyms BGP; OC; OCN
Locus ID 632
UniProt ID P02818
Cytogenetics 1q22
Summary This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. provided by RefSeq, Jun 2015
Protein Families ES Cell Differentiation/IPS, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Osteocalcin" proteins (4)
SKU Description Size Price
LC404673 Lyophilized BGLAP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404673 Transient overexpression lysate of bone gamma-carboxyglutamate (gla) protein (BGLAP) (as WB positive control) 100 ug
$436.00
TP320555 Recombinant protein of human bone gamma-carboxyglutamate (gla) protein (BGLAP), 20 µg 20 ug
$867.00
TP701039 Purified recombinant protein of Human bone gamma-carboxyglutamate (gla) protein (BGLAP), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products