OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RIT1 (NM_006912) Human Mass Spec Standard

Be the first to review this product
SKU
PH320552
RIT1 MS Standard C13 and N15-labeled recombinant protein (NP_008843)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA314447 Rabbit polyclonal anti-RIT1 antibody
100 ul
$380.00
LY416316 Transient overexpression lysate of Ras-like without CAAX 1 (RIT1) (as WB positive control) 100 ug
$436.00

Other products for "RIT1 or NM_006912"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220552
Predicted MW 25.1 kDa
Protein Sequence
Protein Sequence
>RC220552 protein sequence
Red=Cloning site Green=Tags(s)

MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPAN
LDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQ
LRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSP
FRKKKDSVT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008843
RefSeq Size 3455
RefSeq ORF 657
Synonyms NS8; RIBB; RIT; ROC1
Locus ID 6016
UniProt ID Q92963
Cytogenetics 1q22
Summary This gene encodes a member of a subfamily of Ras-related GTPases. The encoded protein is involved in regulating p38 MAPK-dependent signaling cascades related to cellular stress. This protein also cooperates with nerve growth factor to promote neuronal development and regeneration. Alternate splicing results in multiple transcript variants. provided by RefSeq, Feb 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RIT1" proteins (3)
SKU Description Size Price
LC416316 Lyophilized RIT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416316 Transient overexpression lysate of Ras-like without CAAX 1 (RIT1) (as WB positive control) 100 ug
$436.00
TP320552 Recombinant protein of human Ras-like without CAAX 1 (RIT1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products