OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FHL2 (NM_201555) Human Mass Spec Standard

Be the first to review this product
SKU
PH320395
FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_963849)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349985 Rabbit Polyclonal Anti-FHL2 Antibody
100 ul
$205.00
LY404459 Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "FHL2 or NM_201555"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220395
Predicted MW 32.2 kDa
Protein Sequence
Protein Sequence
>RC220395 protein sequence
Red=Cloning site Green=Tags(s)

MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQ
CRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKS
FIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCL
NCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_963849
RefSeq Size 1907
RefSeq ORF 837
Synonyms AAG11; DRAL; FHL-2; SLIM-3; SLIM3
Locus ID 2274
UniProt ID Q14192
Cytogenetics 2q12.2
Summary This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified. provided by RefSeq, Jan 2016
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FHL2" proteins (16)
SKU Description Size Price
PH300398 FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_963851) 10 ug
$3,360.00
PH319762 FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_001034581) 10 ug
$3,360.00
PH320344 FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_001441) 10 ug
$3,360.00
LC404459 Lyophilized FHL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404460 Lyophilized FHL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419930 Lyophilized FHL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422060 Lyophilized FHL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404459 Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404460 Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY419930 Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422060 Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP300398 Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 4, 20 µg 20 ug
$867.00
TP319762 Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 5, 20 µg 20 ug
$867.00
TP320344 Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 1, 20 µg 20 ug
$867.00
TP320395 Recombinant protein of human four and a half LIM domains 2 (FHL2), transcript variant 2, 20 µg 20 ug
$867.00
TP760738 Purified recombinant protein of Human four and a half LIM domains 2 (FHL2), transcript variant 5, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products