SYCE1 (NM_130784) Human Mass Spec Standard

CAT#: PH320187

SYCE1 MS Standard C13 and N15-labeled recombinant protein (NP_570140)

Product Images

Coomassie blue staining of purified SYCE1 protein (Cat# TP320187). The protein was produced from HEK293T cells transfected with SYCE1 cDNA clone (Cat# RC220187) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220187
• Predicted MW: 32.4 kDa
• Protein Sequence:
  Sequence Link

  >RC220187 representing NM_130784
  Red=Cloning site Green=Tags(s)
  
  MEMVQKLQKVGSLEPRVEVLINRINEVQQAKKKANKDLGEARTICEALQKELDSLHGEKVHLKEILSKKQ
  ETLRILRLHCQEKESEAHRKHTMLQECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFH
  MPERLAKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEAAATVQLFQEE
  HRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVAPRPGRPVTW
  WS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_570140
• RefSeq Size: 1400
• RefSeq ORF: 846
• Synonyms: C10orf94; CT76; POF12; SPGF15
• Locus ID: 93426
• UniProt ID: Q8N0S2
• Cytogenetics: 10q26.3
• Summary: This gene encodes a member of the synaptonemal complex, which links homologous chromosomes during prophase I of meiosis. The tripartite structure of the complex is highly conserved amongst metazoans. It consists of two lateral elements and a central region formed by transverse elements and a central element. The protein encoded by this gene localizes to the central element and is required for initiation and elongation of the synapsis. Allelic variants of this gene have been associated with premature ovarian failure and spermatogenic failure. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]