OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LHFPL3 (NM_199000) Human Mass Spec Standard

Be the first to review this product
SKU
PH320013
LHFPL3 MS Standard C13 and N15-labeled recombinant protein (NP_945351)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY404712 Transient overexpression lysate of lipoma HMGIC fusion partner-like 3 (LHFPL3) (as WB positive control) 100 ug
$436.00

Other products for "LHFPL3 or NM_199000"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC220013
Predicted MW 25.8 kDa
Protein Sequence
Protein Sequence
>RC220013 protein sequence
Red=Cloning site Green=Tags(s)

MPGAAAAAAAAAAAMLPTQEAAKLYHTNYVRNSRAIGVLWAIFTICFAIVNVVCFIQPYWIGDGVDTPQA
GYFGLFHYCIGNGFSRELTCRGSFTDFSTLPSGAFKAASFFIGLSMMLIIACIICFTLFFFCNTATVYKI
CAWMQLTSAACLVLGCMIFPDGWDSDEVKRMCGEKTDKYTLGACSVRWAYILAIIGILDALILSFLAFVL
GNRQDSLMAEELKAENKVLLSQYSLE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_945351
RefSeq Size 3191
RefSeq ORF 708
Synonyms LHFPL4
Locus ID 375612
UniProt ID Q86UP9
Cytogenetics 7q22.2-q22.3
Summary This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. A partial gene fragment named LHFPL4 corresponds to a portion of the first exon of this gene. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LHFPL3" proteins (3)
SKU Description Size Price
LC404712 Lyophilized LHFPL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404712 Transient overexpression lysate of lipoma HMGIC fusion partner-like 3 (LHFPL3) (as WB positive control) 100 ug
$436.00
TP320013 Recombinant protein of human lipoma HMGIC fusion partner-like 3 (LHFPL3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products