OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBFD1 (NM_019116) Human Mass Spec Standard

Be the first to review this product
SKU
PH319973
UBFD1 MS Standard C13 and N15-labeled recombinant protein (NP_061989)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA315615 Rabbit polyclonal anti-UBFD1 antibody
100 ul
$380.00
LY412742 Transient overexpression lysate of ubiquitin family domain containing 1 (UBFD1) (as WB positive control) 100 ug
$436.00

Other products for "UBFD1 or NM_019116"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219973
Predicted MW 33.2 kDa
Protein Sequence
Protein Sequence
>RC219973 representing NM_019116
Red=Cloning site Green=Tags(s)

MAAAGAPDGMEEPGMDTEAETVATEAPARPVNCLEAEAAAGAAAEDSGAARGSLQPAPAQPPGDPAAQAS
VSNGEDAGGGAGRELVDLKIIWNKTKHDVKFPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLR
EIKVTSGAKIMVVGSTINDVLAVNTPKDAAQQDAKAEENKKEPLCRQKQHRKVLDKGKPEDVMPSVKGAQ
ERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDYHMMAFQLGPT
EASYYWVYWVPTQYVDAIKDTVLGKWQYF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061989
RefSeq Size 4931
RefSeq ORF 927
Synonyms UBPH
Locus ID 56061
UniProt ID O14562
Cytogenetics 16p12.2
Summary May play a role as NF-kappa-B regulator.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBFD1" proteins (3)
SKU Description Size Price
LC412742 Lyophilized UBFD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412742 Transient overexpression lysate of ubiquitin family domain containing 1 (UBFD1) (as WB positive control) 100 ug
$436.00
TP319973 Recombinant protein of human ubiquitin family domain containing 1 (UBFD1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products