OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DGKE (NM_003647) Human Mass Spec Standard

Be the first to review this product
SKU
PH319913
DGKE MS Standard C13 and N15-labeled recombinant protein (NP_003638)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA338224 Rabbit Polyclonal Anti-DGKE Antibody
100 ul
$585.00
LY418530 Transient overexpression lysate of diacylglycerol kinase, epsilon 64kDa (DGKE) (as WB positive control) 100 ug
$665.00

Other products for "DGKE or NM_003647"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219913
Predicted MW 63.7 kDa
Protein Sequence
Protein Sequence
>RC219913 representing NM_003647
Red=Cloning site Green=Tags(s)

MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQ
PTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMV
CKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPSYLTSINQMRKDKKTDYEVLA
SKLGKQWTPLIILANSRSGTNMGEGLLGEFRILLNPVQVFDVTKTPPIKALQLCTLLPYYSARVLVCGGD
GTVGWVLDAVDDMKIKGQEKYIPQVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRW
KVQVTNKGYYNLRKPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQEC
KDLNKKVELELDGERVALPSLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEVVGVYGSFHCAQ
IQVKLANPFRIGQAHTVRLILKCSMMPMQVDGEPWAQGPCTVTITHKTHAMMLYFSGEQTDDDISSTSDQ
EDIKATE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003638
RefSeq Size 2562
RefSeq ORF 1701
Synonyms AHUS7; DAGK5; DAGK6; DGK; NPHS7
Locus ID 8526
UniProt ID P52429
Cytogenetics 17q22
Summary Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Protein Pathways Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DGKE" proteins (3)
SKU Description Size Price
LC418530 Lyophilized DGKE HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418530 Transient overexpression lysate of diacylglycerol kinase, epsilon 64kDa (DGKE) (as WB positive control) 100 ug
$665.00
TP319913 Recombinant protein of human diacylglycerol kinase, epsilon 64kDa (DGKE), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products