OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRB1 (NM_199354) Human Mass Spec Standard

Be the first to review this product
SKU
PH319911
PRB1 MS Standard C13 and N15-labeled recombinant protein (NP_955386)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA361904 PRB1 Antibody - middle region
100 ul
$585.00
LY404537 Transient overexpression lysate of proline-rich protein BstNI subfamily 1 (PRB1), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "PRB1 or NM_199354"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219911
Predicted MW 16 kDa
Protein Sequence
Protein Sequence
>RC219911 representing NM_199354
Red=Cloning site Green=Tags(s)

MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQG
PLPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEGNNPQ
GPPPPAGGNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_955386
RefSeq Size 714
RefSeq ORF 534
Synonyms PM; PMF; PMS; PRB1L; PRB1M
Locus ID 5542
UniProt ID P04280
Cytogenetics 12p13.2
Summary This gene encodes a member of the heterogeneous family of basic, proline-rich, human salivary glycoproteins. The encoded preproprotein undergoes proteolytic processing to generate one or more mature peptides before secretion from the parotid glands. Multiple alleles of this gene exhibiting variations in the length of the tandem repeats have been identified. The reference genome encodes the "Medium" allele. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. provided by RefSeq, Nov 2015
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRB1" proteins (3)
SKU Description Size Price
LC404537 Lyophilized PRB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404537 Transient overexpression lysate of proline-rich protein BstNI subfamily 1 (PRB1), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP319911 Recombinant protein of human proline-rich protein BstNI subfamily 1 (PRB1), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products