OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SBSN (NM_198538) Human Mass Spec Standard

Be the first to review this product
SKU
PH319831
SBSN MS Standard C13 and N15-labeled recombinant protein (NP_940940)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331355 Rabbit Polyclonal Anti-SBSN Antibody
100 ul
$585.00
LY404842 Transient overexpression lysate of suprabasin (SBSN), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SBSN or NM_198538"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219831
Predicted MW 25.2 kDa
Protein Sequence
Protein Sequence
>RC219831 representing NM_198538
Red=Cloning site Green=Tags(s)

MHLARLVGSCSLLLLLGALSGWAASDDPIEKVIEGINRGLSNAEREVGKALDGINSGITHAGREVEKVFN
GLSNMGSHTGKELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQAGKEADKAVQGFHTG
VHQAGKEAEKLGQGVNHAADQAGKEVEKLGQGAHHAAGQAGKELQNAHNGVNQASKEANQLLNGNHQSGS
SSHQGGATTTPLASGASVNTPFINLPALWRSVANIMP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_940940
RefSeq Size 957
RefSeq ORF 741
Synonyms UNQ698
Locus ID 374897
UniProt ID Q6UWP8
Cytogenetics 19q13.12
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SBSN" proteins (5)
SKU Description Size Price
LC404842 Lyophilized SBSN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431506 Lyophilized SBSN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404842 Transient overexpression lysate of suprabasin (SBSN), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431506 Transient overexpression lysate of suprabasin (SBSN), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP319831 Recombinant protein of human suprabasin (SBSN), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products