OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KCTD1 (NM_198991) Human Mass Spec Standard

Be the first to review this product
SKU
PH319713
KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_945342)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331513 Rabbit Polyclonal Anti-KCTD1 Antibody
100 ul
$585.00
LY404704 Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "KCTD1 or NM_198991"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219713
Predicted MW 29.4 kDa
Protein Sequence
Protein Sequence
>RC219713 protein sequence
Red=Cloning site Green=Tags(s)

MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDS
LKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPC
ECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERL
QQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_945342
RefSeq Size 1754
RefSeq ORF 771
Synonyms C18orf5
Locus ID 284252
UniProt ID Q719H9
Cytogenetics 18q11.2
Summary This gene encodes a protein containing a BTB (Broad-complex, tramtrack and bric a brac), also known as a POZ (POxvirus and zinc finger) protein-protein interaction domain. The encoded protein negatively regulates the AP-2 family of transcription factors and the Wnt signaling pathway. A mechanism for the modulation of Wnt signaling has been proposed in which the encoded protein enhances ubiquitination and degradation of the beta-catenin protein. Mutations in this gene have been identified in Scalp-ear-nipple (SEN) syndrome. provided by RefSeq, May 2017
Protein Families Ion Channels: Other
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KCTD1" proteins (7)
SKU Description Size Price
PH326740 KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_001129677) 10 ug
$3,360.00
LC404704 Lyophilized KCTD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427853 Lyophilized KCTD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404704 Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427853 Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP319713 Recombinant protein of human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2, 20 µg 20 ug
$867.00
TP326740 Recombinant protein of human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products