KCTD1 (NM_001136205) Human Mass Spec Standard

SKU
PH326740
KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_001129677)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226740]
Predicted MW 29.4 kDa
Protein Sequence
Protein Sequence
>RC226740 protein sequence
Red=Cloning site Green=Tags(s)

MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDS
LKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPC
ECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERL
QQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129677
RefSeq Size 2174
RefSeq ORF 771
Synonyms C18orf5
Locus ID 284252
UniProt ID Q719H9
Cytogenetics 18q11.2
Summary This gene encodes a protein containing a BTB (Broad-complex, tramtrack and bric a brac), also known as a POZ (POxvirus and zinc finger) protein-protein interaction domain. The encoded protein negatively regulates the AP-2 family of transcription factors and the Wnt signaling pathway. A mechanism for the modulation of Wnt signaling has been proposed in which the encoded protein enhances ubiquitination and degradation of the beta-catenin protein. Mutations in this gene have been identified in Scalp-ear-nipple (SEN) syndrome. [provided by RefSeq, May 2017]
Protein Families Ion Channels: Other
Write Your Own Review
You're reviewing:KCTD1 (NM_001136205) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH319713 KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_945342) 10 ug
$3,255.00
LC404704 KCTD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427853 KCTD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404704 Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2 100 ug
$436.00
LY427853 Transient overexpression lysate of potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1 100 ug
$436.00
TP319713 Recombinant protein of human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326740 Recombinant protein of human potassium channel tetramerisation domain containing 1 (KCTD1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.