OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COX8C (NM_182971) Human Mass Spec Standard

Be the first to review this product
SKU
PH319625
COX8C MS Standard C13 and N15-labeled recombinant protein (NP_892016)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA371698 COX8C rabbit polyclonal antibody
100 ul
$310.00
LY405286 Transient overexpression lysate of cytochrome c oxidase subunit 8C (COX8C), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "COX8C or NM_182971"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219625
Predicted MW 8.1 kDa
Protein Sequence
Protein Sequence
>RC219625 protein sequence
Red=Cloning site Green=Tags(s)

MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFR
RN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_892016
RefSeq Size 531
RefSeq ORF 216
Synonyms COX8-3
Locus ID 341947
UniProt ID Q7Z4L0
Cytogenetics 14q32.12
Summary This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COX8C" proteins (3)
SKU Description Size Price
LC405286 Lyophilized COX8C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405286 Transient overexpression lysate of cytochrome c oxidase subunit 8C (COX8C), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP319625 Recombinant protein of human cytochrome c oxidase subunit 8C (COX8C), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products