OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

INPP4B (NM_001101669) Human Mass Spec Standard

Be the first to review this product
SKU
PH319612
INPP4B MS Standard C13 and N15-labeled recombinant protein (NP_001095139)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418390 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type II, 105kDa (INPP4B), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "INPP4B or NM_001101669"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219612
Predicted MW 104.6 kDa
Protein Sequence
Protein Sequence
>RC219612 representing NM_001101669
Red=Cloning site Green=Tags(s)

MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILACKDLVAPVRDRKLNTLVQISVIHP
VEQSLTRYSSTEIVEGTRDPLFLTGVTFPSEYPIYEETKIKLTVYDVKDKSHDTVRTSVLPEHKDPPPEV
GRSFLGYASFKVGELLKSKEQLLVLSLRTSDGGKVVGTIEVSVVKMGEIEDGEADHITTDVQGQKCALVC
ECTAPESVSGKDNLPFLNSVLKNPVCKLYRFPTSDNKWMRIREQMSESILSFHIPKELISLHIKEDLCRN
QEIKELGELSPHWDNLRKNVLTHCDQMVNMYQDILTELSKETGSSFKSSSSKGEKTLEFVPINLHLQRMQ
VHSPHLKDALYDVITVGAPAAHFQGFKNGGLRKLLHRFETERRNTGYQFIYYSPENTAKAKEVLSNINQL
QPLIATHADLLLNSASQHSPDSLKNSLKMLSEKTELFVHAFKDQLVRSALLALYTARPGGILKKPPSPKS
STEESSPQDQPPVMRGQDSIPHHSDYDEEEWDRVWANVGKSLNCIIAMVDKLIERDGGSEGSGGNNDGEK
EPSLTDAIPSHPREDWYEQLYPLILTLKDCMGEVVNRAKQSLTFVLLQELAYSLPQCLMLTLRRDIVFSQ
ALAGLVCGFIIKLQTSLYDPGFLQQLHTVGLIVQYEGLLSTYSDEIGMLEDMAVGISDLKKVAFKIIEAK
SNDVLPVITGRREHYVVEVKLPARMFESLPLQIKEGQLLHVYPVLFNVGINEQQTLAERFGDVSLQESIN
QENFELLQEYYKIFMEKMPPDYISHFQEQNDLKALLENLLQNIQSKKRKNVEIMWLAATICRKLNGIRFT
CCKSAKDRTSMSVTLEQCSILRDEHQLHKDFFIRALDCMRREGCRIENVLKNIKCRKYAFNMLQLMAFPK
YYRPPEGTYGKADT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001095139
RefSeq Size 4041
RefSeq ORF 2772
Locus ID 8821
UniProt ID O15327
Cytogenetics 4q31.21
Summary INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "INPP4B" proteins (7)
SKU Description Size Price
PH311134 INPP4B MS Standard C13 and N15-labeled recombinant protein (NP_003857) 10 ug
$3,360.00
LC418390 Lyophilized INPP4B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420324 Lyophilized INPP4B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418390 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type II, 105kDa (INPP4B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420324 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type II, 105kDa (INPP4B), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP311134 Recombinant protein of human inositol polyphosphate-4-phosphatase, type II, 105kDa (INPP4B), transcript variant 1, 20 µg 20 ug
$867.00
TP319612 Recombinant protein of human inositol polyphosphate-4-phosphatase, type II, 105kDa (INPP4B), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products