OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TREX2 (NM_080701) Human Mass Spec Standard

Be the first to review this product
SKU
PH319499
TREX2 MS Standard C13 and N15-labeled recombinant protein (NP_542432)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306703 Rabbit Polyclonal TREX2 Antibody
100 ug
$640.00
LY409112 Transient overexpression lysate of three prime repair exonuclease 2 (TREX2) (as WB positive control) 100 ug
$436.00

Other products for "TREX2 or NM_080701"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219499
Predicted MW 25.9 kDa
Protein Sequence
Protein Sequence
>RC219499 representing NM_080701
Red=Cloning site Green=Tags(s)

MSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPF
TAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPR
DTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLA
WADEQARGWAHIEPMYLPPDDPSLEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542432
RefSeq Size 1255
RefSeq ORF 708
Locus ID 11219
UniProt ID Q9BQ50
Cytogenetics Xq28
Summary This gene encodes a nuclear protein with 3' to 5' exonuclease activity. The encoded protein participates in double-stranded DNA break repair, and may interact with DNA polymerase delta. provided by RefSeq, Nov 2012
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TREX2" proteins (3)
SKU Description Size Price
LC409112 Lyophilized TREX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409112 Transient overexpression lysate of three prime repair exonuclease 2 (TREX2) (as WB positive control) 100 ug
$436.00
TP319499 Recombinant protein of human three prime repair exonuclease 2 (TREX2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products