OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PLA1A (NM_015900) Human Mass Spec Standard

Be the first to review this product
SKU
PH319486
PLA1A MS Standard C13 and N15-labeled recombinant protein (NP_056984)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA319922 Rabbit Polyclonal PLA1A Antibody
100 ug
$640.00
LY414332 Transient overexpression lysate of phospholipase A1 member A (PLA1A) (as WB positive control) 100 ug
$665.00

Other products for "PLA1A or NM_015900"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219486
Predicted MW 49.5 kDa
Protein Sequence
Protein Sequence
>RC219486 representing NM_015900
Red=Cloning site Green=Tags(s)

MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSNPSCGQLVEGS
SDLQNSGFNATLGTKLIIHGFRVLGTKPSWIDTFIRTLLRATNANVIAVDWIYGSTGVYFSAVKNVIKLS
LEISLFLNKLLVLGVSESSIHIIGVSLGAHVGGMVGQLFGGQLGQITGLDPAGPEYTRASVEERLDAGDA
LFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAF
PCASYKAFLAGRCLDCFNPFLLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKEL
RNKDTNIEVTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFC
TALLPVNDREKMVCLPEPVNLQASVTVSCDLKIACV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056984
RefSeq Size 1758
RefSeq ORF 1368
Synonyms PS-PLA1; PSPLA1
Locus ID 51365
UniProt ID Q53H76
Cytogenetics 3q13.33
Summary The protein encoded by this gene is a phospholipase that hydrolyzes fatty acids at the sn-1 position of phosphatidylserine and 1-acyl-2-lysophosphatidylserine. This secreted protein hydrolyzes phosphatidylserine in liposomes. Three transcript variants encoding different isoforms have been found for this gene.provided by RefSeq, May 2011
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PLA1A" proteins (3)
SKU Description Size Price
LC414332 Lyophilized PLA1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414332 Transient overexpression lysate of phospholipase A1 member A (PLA1A) (as WB positive control) 100 ug
$665.00
TP319486 Purified recombinant protein of Homo sapiens phospholipase A1 member A (PLA1A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products