TREML1 (NM_178174) Human Mass Spec Standard

CAT#: PH319476

TREML1 MS Standard C13 and N15-labeled recombinant protein (NP_835468)

Product Images

Coomassie blue staining of purified TREML1 protein (Cat# TP319476). The protein was produced from HEK293T cells transfected with TREML1 cDNA clone (Cat# RC219476) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219476
• Predicted MW: 32.5 kDa
• Protein Sequence:
  Sequence Link

  >RC219476 representing NM_178174
  Red=Cloning site Green=Tags(s)
  
  MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRR
  APAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAEN
  AFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVMAKRKQGNRLGVCGRFLSSRVSGMNPS
  SVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVT
  YATVIFPGGNKGGGTSCGPAQNPPNNQTPSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_835468
• RefSeq Size: 980
• RefSeq ORF: 933
• Synonyms: dJ238O23.3; GLTL1825; PRO3438; TLT-1; TLT1
• Locus ID: 340205
• UniProt ID: Q86YW5
• Cytogenetics: 6p21.1
• Summary: This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in platelet aggregation, inflammation, and cellular activation and has been linked to Gray platelet syndrome. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012]
• Protein Families: Druggable Genome, Transmembrane