TREML1 (NM_178174) Human Recombinant Protein

SKU
TP319476
Recombinant protein of human triggering receptor expressed on myeloid cells-like 1 (TREML1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219476 representing NM_178174
Red=Cloning site Green=Tags(s)

MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRR
APAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAEN
AFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVMAKRKQGNRLGVCGRFLSSRVSGMNPS
SVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVT
YATVIFPGGNKGGGTSCGPAQNPPNNQTPSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_835468
Locus ID 340205
UniProt ID Q86YW5
Cytogenetics 6p21.1
RefSeq Size 980
RefSeq ORF 933
Synonyms dJ238O23.3; GLTL1825; PRO3438; TLT-1; TLT1
Summary This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in platelet aggregation, inflammation, and cellular activation and has been linked to Gray platelet syndrome. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TREML1 (NM_178174) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH319476 TREML1 MS Standard C13 and N15-labeled recombinant protein (NP_835468) 10 ug
$3,255.00
LC406014 TREML1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406014 Transient overexpression lysate of triggering receptor expressed on myeloid cells-like 1 (TREML1) 100 ug
$436.00
TP720334 Recombinant protein of human triggering receptor expressed on myeloid cells-like 1 (TREML1) 10 ug
$215.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.