TREML1 Rabbit Polyclonal Antibody

SKU TA337742

Rabbit Polyclonal Anti-TREML1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TREML1 antibody is: synthetic peptide directed towards the middle region of Human TREML1. Synthetic peptide located within the following region: GSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 22 kDa
• Gene Name: triggering receptor expressed on myeloid cells like 1
• Database Link:
  NP_835468
  Q86YW5
• Background: TREML1 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 and TREM2, but it has distinct structural and functional properties. TREML1 enhances calcium signaling in an SHP2-dependent manner.
• Synonyms: dJ238O23.3; GLTL1825; PRO3438; TLT-1; TLT1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane