TREML1 (NM_178174) Human Mass Spec Standard

SKU
PH319476
TREML1 MS Standard C13 and N15-labeled recombinant protein (NP_835468)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219476]
Predicted MW 32.5 kDa
Protein Sequence
Protein Sequence
>RC219476 representing NM_178174
Red=Cloning site Green=Tags(s)

MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRR
APAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAEN
AFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVMAKRKQGNRLGVCGRFLSSRVSGMNPS
SVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVT
YATVIFPGGNKGGGTSCGPAQNPPNNQTPSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_835468
RefSeq Size 980
RefSeq ORF 933
Synonyms dJ238O23.3; GLTL1825; PRO3438; TLT-1; TLT1
Locus ID 340205
UniProt ID Q86YW5
Cytogenetics 6p21.1
Summary This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in platelet aggregation, inflammation, and cellular activation and has been linked to Gray platelet syndrome. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TREML1 (NM_178174) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406014 TREML1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406014 Transient overexpression lysate of triggering receptor expressed on myeloid cells-like 1 (TREML1) 100 ug
$436.00
TP319476 Recombinant protein of human triggering receptor expressed on myeloid cells-like 1 (TREML1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720334 Recombinant protein of human triggering receptor expressed on myeloid cells-like 1 (TREML1) 10 ug
$215.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.