OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BAGE2 (NM_182482) Human Mass Spec Standard

Be the first to review this product
SKU
PH319432
BAGE2 MS Standard C13 and N15-labeled recombinant protein (NP_872288)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367855 BAGE2 rabbit polyclonal antibody
100 ul
$310.00
LY405543 Transient overexpression lysate of B melanoma antigen family, member 2 (BAGE2) (as WB positive control) 100 ug
$436.00

Other products for "BAGE2 or NM_182482"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219432
Predicted MW 12 kDa
Protein Sequence
Protein Sequence
>RC219432 representing NM_182482
Red=Cloning site Green=Tags(s)

MAAGVVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPRCIIILVLQEP
TPFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATARETS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872288
RefSeq Size 1891
RefSeq ORF 327
Synonyms CT2.2
Locus ID 85319
Cytogenetics 21p11.2
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BAGE2" proteins (3)
SKU Description Size Price
LC405543 Lyophilized BAGE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405543 Transient overexpression lysate of B melanoma antigen family, member 2 (BAGE2) (as WB positive control) 100 ug
$436.00
TP319432 Recombinant protein of human B melanoma antigen family, member 2 (BAGE2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products