OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MT1E (NM_175617) Human Mass Spec Standard

Be the first to review this product
SKU
PH319414
MT1E MS Standard C13 and N15-labeled recombinant protein (NP_783316)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY406270 Transient overexpression lysate of metallothionein 1E (MT1E) (as WB positive control) 100 ug
$436.00

Other products for "MT1E or NM_175617"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219414
Predicted MW 6 kDa
Protein Sequence
Protein Sequence
>RC219414 protein sequence
Red=Cloning site Green=Tags(s)

MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_783316
RefSeq Size 519
RefSeq ORF 183
Synonyms MT-1E; MT-IE; MT1; MTD
Locus ID 4493
UniProt ID P04732
Cytogenetics 16q13
Summary Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MT1E" proteins (3)
SKU Description Size Price
LC406270 Lyophilized MT1E HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406270 Transient overexpression lysate of metallothionein 1E (MT1E) (as WB positive control) 100 ug
$436.00
TP319414 Recombinant protein of human metallothionein 1E (MT1E), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products