MT1E (NM_175617) Human Mass Spec Standard

CAT#: PH319414

MT1E MS Standard C13 and N15-labeled recombinant protein (NP_783316)

Product Images

Coomassie blue staining of purified MT1E protein (Cat# TP319414). The protein was produced from HEK293T cells transfected with MT1E cDNA clone (Cat# RC219414) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC219414
• Predicted MW: 6 kDa
• Protein Sequence:
  Sequence Link

  >RC219414 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA
  
  TRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_783316
• RefSeq Size: 519
• RefSeq ORF: 183
• Synonyms: MT-1E; MT-IE; MT1; MTD
• Locus ID: 4493
• UniProt ID: P04732
• Cytogenetics: 16q13
• Summary: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome