OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EDARADD (NM_080738) Human Mass Spec Standard

Be the first to review this product
SKU
PH319198
EDARADD MS Standard C13 and N15-labeled recombinant protein (NP_542776)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365280 EDARADD rabbit polyclonal antibody
100 ul
$310.00
LY403313 Transient overexpression lysate of EDAR-associated death domain (EDARADD), transcript variant B (as WB positive control) 100 ug
$436.00

Other products for "EDARADD or NM_080738"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219198
Predicted MW 23.5 kDa
Protein Sequence
Protein Sequence
>RC219198 representing NM_080738
Red=Cloning site Green=Tags(s)

MASPDDPLRADHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFP
DSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSY
DELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542776
RefSeq Size 2891
RefSeq ORF 615
Synonyms ECTD11A; ECTD11B; ED3; EDA3
Locus ID 128178
UniProt ID Q8WWZ3
Cytogenetics 1q42.3-q43
Summary This gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defective development of hair, teeth, and eccrine sweat glands. The protein encoded by this gene is a death domain-containing protein, and is found to interact with EDAR, a death domain receptor known to be required for the development of hair, teeth and other ectodermal derivatives. This protein and EDAR are coexpressed in epithelial cells during the formation of hair follicles and teeth. Through its interaction with EDAR, this protein acts as an adaptor, and links the receptor to downstream signaling pathways. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EDARADD" proteins (5)
SKU Description Size Price
LC403313 Lyophilized EDARADD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403442 Lyophilized EDARADD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403313 Transient overexpression lysate of EDAR-associated death domain (EDARADD), transcript variant B (as WB positive control) 100 ug
$436.00
LY403442 Transient overexpression lysate of EDAR-associated death domain (EDARADD), transcript variant A (as WB positive control) 100 ug
$436.00
TP319198 Recombinant protein of human EDAR-associated death domain (EDARADD), transcript variant B, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products