OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD1B (NM_001764) Human Mass Spec Standard

Be the first to review this product
SKU
PH319131
CD1B MS Standard C13 and N15-labeled recombinant protein (NP_001755)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367956 CD1B rabbit polyclonal antibody
100 ul
$310.00
LY419761 Transient overexpression lysate of CD1b molecule (CD1B) (as WB positive control) 100 ug
$436.00

Other products for "CD1B or NM_001764"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219131
Predicted MW 36.9 kDa
Protein Sequence
Protein Sequence
>RC219131 protein sequence
Red=Cloning site Green=Tags(s)

MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKP
WSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLD
FLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQRQVKPEAWLS
SGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCR
VKHSSLEGQDIILYWRNPTSIGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001755
RefSeq Size 1396
RefSeq ORF 999
Synonyms CD1; CD1A; R1
Locus ID 910
UniProt ID P29016
Cytogenetics 1q23.1
Summary This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD1B" proteins (4)
SKU Description Size Price
LC419761 Lyophilized CD1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419761 Transient overexpression lysate of CD1b molecule (CD1B) (as WB positive control) 100 ug
$436.00
TP319131 Recombinant protein of human CD1b molecule (CD1B), 20 µg 20 ug
$867.00
TP700271 Purified recombinant protein of human CD1B molecule (CD1B), with C-terminal Fc tag, expressed in human cells, 20 µg 20 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products