OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ELP4 (NM_019040) Human Mass Spec Standard

Be the first to review this product
SKU
PH319128
ELP4 MS Standard C13 and N15-labeled recombinant protein (NP_061913)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809150 ELP4 mouse monoclonal antibody,clone OTI3A4 100 ul
$447.00
LY412806 Transient overexpression lysate of elongation protein 4 homolog (S. cerevisiae) (ELP4) (as WB positive control) 100 ug
$436.00

Other products for "ELP4 or NM_019040"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219128
Predicted MW 47 kDa
Protein Sequence
Protein Sequence
>RC219128 representing NM_019040
Red=Cloning site Green=Tags(s)

MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPAL
DQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKK
EFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASNWHGFFLPEKIS
STLKVEPCSLTPGYTKLLQFIQNIIYEEGFDGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGNSHS
LTKFLYVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHI
RQIPRLNNLICDESDVKDLAFKLKRKLFTIERLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKK
HLDF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061913
RefSeq Size 2341
RefSeq ORF 1272
Synonyms AN; AN2; C11orf19; dJ68P15A.1; hELP4; PAX6NEB; PAXNEB
Locus ID 26610
UniProt ID Q96EB1
Cytogenetics 11p13
Summary This gene encodes a component of the six subunit elongator complex, a histone acetyltransferase complex that associates directly with RNA polymerase II during transcriptional elongation. The human gene can partially complement sensitivity phenotypes of yeast ELP4 deletion mutants. This gene has also been associated with Rolandic epilepsy. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ELP4" proteins (3)
SKU Description Size Price
LC412806 Lyophilized ELP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412806 Transient overexpression lysate of elongation protein 4 homolog (S. cerevisiae) (ELP4) (as WB positive control) 100 ug
$436.00
TP319128 Recombinant protein of human elongation protein 4 homolog (S. cerevisiae) (ELP4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products