OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TrkC (NTRK3) (NM_001012338) Human Mass Spec Standard

Be the first to review this product
SKU
PH319113
NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_001012338)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500537 Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI2B8 (formerly 2B8) 100 ul
$447.00
LY400902 Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "TrkC or NM_001012338"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219113
Predicted MW 94.43 kDa
Protein Sequence
Protein Sequence
>RC219113 representing NM_001012338
Red=Cloning site Green=Tags(s)

MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNAS
INITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLT
TLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLP
EISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGF
TLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHV
EYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITT
PSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNL
SPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLR
AHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGM
SRDVYSTDYYRLFNPSGNDFCIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQP
WFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001012338
RefSeq Size 2860
RefSeq ORF 2517
Synonyms gp145(trkC); GP145-TrkC; TRKC
Locus ID 4916
UniProt ID Q16288
Cytogenetics 15q25.3
Summary This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2011
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Neurotrophin signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TrkC" proteins (9)
SKU Description Size Price
PH303781 NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_001007157) 10 ug
$3,360.00
PH313333 NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_002521) 10 ug
$3,360.00
LC400902 Lyophilized NTRK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400902 Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP303781 Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3, 20 µg 20 ug
$867.00
TP313333 Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2, 20 µg 20 ug
$867.00
TP319113 Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, 20 µg 20 ug
$867.00
TP700136 Purified recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP710140 Recombinant protein of human mitotic spindle organizing protein 2A (MZT2A), residues 32-429aa, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products