OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DOPA Decarboxylase (DDC) (NM_001082971) Human Mass Spec Standard

Be the first to review this product
SKU
PH319037
DDC MS Standard C13 and N15-labeled recombinant protein (NP_001076440)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375369 DDC Rabbit polyclonal Antibody
100 ul
$410.00
LY421202 Transient overexpression lysate of dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "DOPA Decarboxylase or NM_001082971"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219037
Predicted MW 53.9 kDa
Protein Sequence
Protein Sequence
>RC219037 protein sequence
Red=Cloning site Green=Tags(s)

MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTH
WHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEG
GGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIP
SDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFI
CPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQ
IPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001076440
RefSeq Size 2090
RefSeq ORF 1440
Synonyms AADC
Locus ID 1644
UniProt ID P20711
Cytogenetics 7p12.2-p12.1
Summary The encoded protein catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Defects in this gene are the cause of aromatic L-amino-acid decarboxylase deficiency (AADCD). AADCD deficiency is an inborn error in neurotransmitter metabolism that leads to combined serotonin and catecholamine deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. provided by RefSeq, Jun 2011
Protein Families Druggable Genome
Protein Pathways Histidine metabolism, Metabolic pathways, Phenylalanine metabolism, Tryptophan metabolism, Tyrosine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DOPA Decarboxylase" proteins (7)
SKU Description Size Price
PH301345 DDC MS Standard C13 and N15-labeled recombinant protein (NP_000781) 10 ug
$3,360.00
LC400270 Lyophilized DDC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421202 Lyophilized DDC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400270 Transient overexpression lysate of dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421202 Transient overexpression lysate of dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP301345 Recombinant protein of human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2, 20 µg 20 ug
$737.00
TP319037 Recombinant protein of human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products