DOPA Decarboxylase (DDC) (NM_000790) Human Mass Spec Standard

SKU
PH301345
DDC MS Standard C13 and N15-labeled recombinant protein (NP_000781)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201345]
Predicted MW 53.9 kDa
Protein Sequence
Protein Sequence
>RC201345 protein sequence
Red=Cloning site Green=Tags(s)

MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTH
WHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEG
GGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIP
SDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFI
CPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQ
IPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000781
RefSeq Size 1975
RefSeq ORF 1440
Synonyms AADC
Locus ID 1644
UniProt ID P20711
Cytogenetics 7p12.2-p12.1
Summary The encoded protein catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Defects in this gene are the cause of aromatic L-amino-acid decarboxylase deficiency (AADCD). AADCD deficiency is an inborn error in neurotransmitter metabolism that leads to combined serotonin and catecholamine deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2011]
Protein Families Druggable Genome
Protein Pathways Histidine metabolism, Metabolic pathways, Phenylalanine metabolism, Tryptophan metabolism, Tyrosine metabolism
Write Your Own Review
You're reviewing:DOPA Decarboxylase (DDC) (NM_000790) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH319037 DDC MS Standard C13 and N15-labeled recombinant protein (NP_001076440) 10 ug
$3,255.00
LC400270 DDC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421202 DDC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400270 Transient overexpression lysate of dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2 100 ug
$436.00
LY421202 Transient overexpression lysate of dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1 100 ug
$665.00
TP301345 Recombinant protein of human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2, 20 µg 20 ug
$737.00
TP319037 Recombinant protein of human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.