OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAGEA4 (NM_001011548) Human Mass Spec Standard

Be the first to review this product
SKU
PH318952
MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011548)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505362 MAGEA4 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9) 100 ul
$447.00
LY429096 Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "MAGEA4 or NM_001011548"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218952
Predicted MW 34.7 kDa
Protein Sequence
Protein Sequence
>RC218952 representing NM_001011548
Red=Cloning site Green=Tags(s)

MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGAS
ALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERV
IKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTI
AMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALA
ETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001011548
RefSeq Size 1724
RefSeq ORF 951
Synonyms CT1.4; MAGE-41; MAGE-X2; MAGE4; MAGE4A; MAGE4B
Locus ID 4103
UniProt ID P43358
Cytogenetics Xq28
Summary This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Several variants encoding the same protein have been found for this gene. provided by RefSeq, Aug 2020
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAGEA4" proteins (13)
SKU Description Size Price
PH304482 MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011549) 10 ug
$3,360.00
PH323991 MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011550) 10 ug
$3,360.00
LC423276 Lyophilized MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425301 Lyophilized MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425302 Lyophilized MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429096 Lyophilized MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423276 Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY425301 Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY425302 Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY429096 Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304482 Purified recombinant protein of Homo sapiens melanoma antigen family A, 4 (MAGEA4), transcript variant 3, 20 µg 20 ug
$867.00
TP318952 Purified recombinant protein of Homo sapiens melanoma antigen family A, 4 (MAGEA4), transcript variant 1, 20 µg 20 ug
$867.00
TP323991 Recombinant protein of human melanoma antigen family A, 4 (MAGEA4), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products