MAGEA4 (NM_001011549) Human Recombinant Protein

SKU
TP304482
Purified recombinant protein of Homo sapiens melanoma antigen family A, 4 (MAGEA4), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204482 protein sequence
Red=Cloning site Green=Tags(s)

MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGAS
ALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERV
IKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTI
AMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALA
ETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001011549
Locus ID 4103
UniProt ID P43358
Cytogenetics Xq28
RefSeq Size 1721
RefSeq ORF 951
Synonyms CT1.4; MAGE-41; MAGE-X2; MAGE4; MAGE4A; MAGE4B
Summary This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Several variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2020]
Write Your Own Review
You're reviewing:MAGEA4 (NM_001011549) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304482 MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011549) 10 ug
$3,255.00
PH318952 MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011548) 10 ug
$3,255.00
PH323991 MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011550) 10 ug
$3,255.00
LC423276 MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425301 MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425302 MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429096 MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY423276 Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 4 100 ug
$436.00
LY425301 Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 1 100 ug
$436.00
LY425302 Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 3 100 ug
$436.00
LY429096 Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 2 100 ug
$436.00
TP318952 Purified recombinant protein of Homo sapiens melanoma antigen family A, 4 (MAGEA4), transcript variant 1, 20 µg 20 ug
$867.00
TP323991 Recombinant protein of human melanoma antigen family A, 4 (MAGEA4), transcript variant 4, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.