OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ANKRD10 (NM_017664) Human Mass Spec Standard

Be the first to review this product
SKU
PH318904
ANKRD10 MS Standard C13 and N15-labeled recombinant protein (NP_060134)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370333 ANKRD10 rabbit polyclonal antibody
100 ul
$310.00
LY413661 Transient overexpression lysate of ankyrin repeat domain 10 (ANKRD10) (as WB positive control) 100 ug
$665.00

Other products for "ANKRD10 or NM_017664"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218904
Predicted MW 44.6 kDa
Protein Sequence
Protein Sequence
>RC218904 representing NM_017664
Red=Cloning site Green=Tags(s)

MSAAGAGAGVEAGFSSEELLSLRFPLHRACRDGDLATLCSLLQQTPHAHLASEDSFYGWTPVHWAAHFGK
LECLVQLVRAGATLNVSTTRYAQTPAHIAAFGGHPQCLVWLIQAGANINKPDCEGETPIHKAARSGSLEC
ISALVANGAHVDLRNASGLTAADIAQTQGFQECAQFLLNLQNCHLNHFYNNGILNGGHQNVFPNHISVGT
NRKRCLEDSEDFGVKKARTEAQSLDSAVPLTNGDTEDDADKMHVDREFAVVTDMKNSSSVSNTLTNGCVI
NGHLDFPSTTPLSGMESRNGQCLTGTNGISSGLAPGQPFPSSQGSLCISGTEEPEKTLRANPELCGSLHL
NGSPSSCIASRPSWVEDIGDNLYYGHYHGFGDTAESIPELNSVVEHSKSVKVQERYDSAVLGTMHLHHGS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060134
RefSeq Size 2495
RefSeq ORF 1260
Locus ID 55608
UniProt ID Q9NXR5
Cytogenetics 13q34
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ANKRD10" proteins (3)
SKU Description Size Price
LC413661 Lyophilized ANKRD10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413661 Transient overexpression lysate of ankyrin repeat domain 10 (ANKRD10) (as WB positive control) 100 ug
$665.00
TP318904 Recombinant protein of human ankyrin repeat domain 10 (ANKRD10), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products