OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PMP22 (NM_153322) Human Mass Spec Standard

Be the first to review this product
SKU
PH318781
PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_696997)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808964 PMP22 mouse monoclonal antibody,clone OTI5D1 100 ul
$447.00
LY403508 Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "PMP22 or NM_153322"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218781
Predicted MW 17.7 kDa
Protein Sequence
Protein Sequence
>RC218781 representing NM_153322
Red=Cloning site Green=Tags(s)

MLLLLLSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMI
LSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYGFAYILAW
VAFPLALLSGVIYVILRKRE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_696997
RefSeq Size 1669
RefSeq ORF 480
Synonyms CIDP; CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110
Locus ID 5376
UniProt ID Q01453
Cytogenetics 17p12
Summary This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Studies suggest two alternately used promoters drive tissue-specific expression. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2013
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PMP22" proteins (9)
SKU Description Size Price
PH316500 PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_000295) 10 ug
$3,360.00
LC403508 Lyophilized PMP22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407108 Lyophilized PMP22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424810 Lyophilized PMP22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403508 Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY407108 Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424810 Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP316500 Recombinant protein of human peripheral myelin protein 22 (PMP22), transcript variant 1, 20 µg 20 ug
$867.00
TP318781 Recombinant protein of human peripheral myelin protein 22 (PMP22), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products