PMP22 (NM_000304) Human Recombinant Protein

SKU
TP316500
Recombinant protein of human peripheral myelin protein 22 (PMP22), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216500 protein sequence
Red=Cloning site Green=Tags(s)

MLLLLLSIIVLHVAVLVLLFVSTIVSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMI
LSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAAAIYTVRHPEWHLNSDYSYGFAYILAW
VAFPLALLSGVIYVILRKRE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_000295
Locus ID 5376
UniProt ID Q01453
Cytogenetics 17p12
RefSeq Size 1861
RefSeq ORF 480
Synonyms CIDP; CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110
Summary This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Studies suggest two alternately used promoters drive tissue-specific expression. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:PMP22 (NM_000304) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH316500 PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_000295) 10 ug
$3,255.00
PH318781 PMP22 MS Standard C13 and N15-labeled recombinant protein (NP_696997) 10 ug
$3,255.00
LC403508 PMP22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407108 PMP22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424810 PMP22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430266 PMP22 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403508 Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 3 100 ug
$436.00
LY407108 Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 2 100 ug
$436.00
LY424810 Transient overexpression lysate of peripheral myelin protein 22 (PMP22), transcript variant 1 100 ug
$436.00
TP318781 Recombinant protein of human peripheral myelin protein 22 (PMP22), transcript variant 3, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.